missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499993

NEK7 Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™

Product Code. 30499993 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499993 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499993 Supplier Novus Biologicals Supplier No. NBP337907AF594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NEK7 Polyclonal antibody specifically detects NEK7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NEK7
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 594
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-301 of human NEK7 (NP_598001.1).,, Sequence:, PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 140609
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.