missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nardilysin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | Nardilysin |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18295392
|
Novus Biologicals
NBP2-58484 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651589
|
Novus Biologicals
NBP2-58484-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nardilysin Polyclonal specifically detects Nardilysin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Nardilysin | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| EC 3.4.24, EC 3.4.24.61, hNRD1, hNRD2, nardilysin, nardilysin (N-arginine dibasic convertase), N-arginine dibasic convertase, NRD convertase, NRD-C | |
| NRDC | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4898 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title