missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MYLK3 Antibody, Novus Biologicals™

MYLK3 Antibody, Novus Biologicals™

Produktkod. 18688628 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Quantity:
100 μg
25 μL
Förpackningsstorlek:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity unitSize
18688628 25 μL 25µL
18657157 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18688628 Leverantör Novus Biologicals Leverantörsnummer NBP26268225ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

MYLK3 Polyclonal antibody specifically detects MYLK3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MYLK3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias caMLCK, Cardiac-MyBP-C-associated Ca/CaM kinase, EC 2.7.11, EC 2.7.11.18, MGC126319, MGC126320, MLC kinase, MLCK2, MLCKcardiac-MyBP-C associated Ca/CaM kinase, myosin light chain kinase 3, putative myosin light chain kinase 3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 91807
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.