missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ MUC3A/MUC3B Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595355
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SW620 whole cell, human COL320 whole cell, human CACO-2 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Specifications
| MUC3A/MUC3B | |
| Polyclonal | |
| Unconjugated | |
| MUC3B | |
| MUC3; MUC3A; MUC3B; mucin 3; mucin 3B, cell surface associated | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 57876 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| Q9H195 | |
| MUC3B | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction