missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPS18B Antibody, Novus Biologicals™

MRPS18B Antibody, Novus Biologicals™

Product Code. 18622056 Shop All Bio Techne Products
Cambia vista
Click to view available options
Quantity:
0.1 mL
25 μL
Dimensione della confezione:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18622056 25 μL 25µL
18624026 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18622056 Fornitore Novus Biologicals N. del fornitore NBP24879225ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

MRPS18B Polyclonal antibody specifically detects MRPS18B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigen MRPS18B
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias 28S ribosomal protein S18-2, mitochondrial, C6orf1428S ribosomal protein S18b, mitochondrial, HSPC183, HumanS18a, mitochondrial ribosomal protein S18-2, mitochondrial ribosomal protein S18B, MRP-S18-2, MRPS18-2DKFZp564H0223, Mrps18-b, MRP-S18-b, PTD017, S18amt, S18mt-b
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 28973
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.