missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMP28 Antibody (3C11), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00079148-M01
This item is not returnable.
View return policy
Description
MMP28 Monoclonal antibody specifically detects MMP28 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| MMP28 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| EC 3.4.24.-, EPILYSIN, matrix metallopeptidase 28, matrix metalloproteinase 28, MM28, MMP25, MMP-28MMP-25, putative MMP28 gene product | |
| MMP28 (NP_077278, 441 a.a. ∽ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF | |
| 0.1 mg | |
| Cancer | |
| 79148 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 3C11 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_077278 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction