missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MID1IP1 Antibody, Novus Biologicals™

MID1IP1 Antibody, Novus Biologicals™

Product Code. 18292977 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18292977 0.1 mL 0.1mL
18467230 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18292977 Supplier Novus Biologicals Supplier No. NBP184629

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MID1IP1 Polyclonal specifically detects MID1IP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MID1IP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ10386, G12-like, Gastrulation-specific G12-like protein, MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like), Mid1-interacting G12-like protein, mid1-interacting protein 1, MIG12MID1 interacting G12-like protein, Protein STRAIT11499, S14R, Spot 14-R, Spot 14-related protein, STRAIT11499, THRSPL
Gene Symbols MID1IP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 58526
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.