missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ MC2R Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595419
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: mouse brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins are peptides derived from pro-opiomelanocortin. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency.
Specifications
| MC2R | |
| Polyclonal | |
| Unconjugated | |
| MC2R | |
| ACTH receptor; ACTHR; ACTH-R; Adrenocorticotropic hormone receptor; adrenocorticotropin receptor; corticotropin receptor; MC2 receptor; MC2R; MC2-R; melanocortin 2 receptor; melanocortin 2 receptor (adrenocorticotropic hormone); melanocortin receptor 2; MGC125798 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 17200, 4158 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| Q01718, Q64326 | |
| MC2R | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW). | |
| 100 μg | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction