missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92981-0.02ml
This item is not returnable.
View return policy
Description
Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Polyclonal antibody specifically detects Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| EC 1.14.11, EC 1.14.11.-, JmjC domain-containing protein 3, JMJD3lysine-specific demethylase 6B, jumonji domain containing 3, histone lysine demethylase, Jumonji domain-containing protein 3, KIAA0346jumonji domain containing 3, lysine (K)-specific demethylase 6B, Lysine demethylase 6B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA | |
| 0.02 mL | |
| Cancer, Chromatin Research, Transcription Factors and Regulators | |
| 23135 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction