missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 589.00 €
Specifications
| Antigen | LSM2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18149157
|
Novus Biologicals
NBP2-38093 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648515
|
Novus Biologicals
NBP2-38093-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LSM2 Polyclonal specifically detects LSM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| LSM2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C6orf28chromosome 6 open reading frame 28, G7b, LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP, snRNP core Sm-like protein Sm-x5, U6 snRNA-associated Sm-like protein LSm2, YBL026W | |
| LSM2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9Y333 | |
| 57819 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title