missing translation for 'onlineSavingsMsg'
Learn More

LONRF3 Antibody (1D5), Novus Biologicals™

Product Code. 18448948 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18448948 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18448948 Supplier Novus Biologicals Supplier No. H00079836M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

LONRF3 Monoclonal antibody specifically detects LONRF3 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen LONRF3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1D5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_079054
Gene Alias LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127
Host Species Mouse
Immunogen RNF127 (NP_079054, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 79836
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.