missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LMP2/PSMB9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
593.00 €
Specifications
| Antigen | LMP2/PSMB9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LMP2/PSMB9 Polyclonal specifically detects LMP2/PSMB9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| LMP2/PSMB9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1 | |
| PSMB9 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5698 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title