missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LDB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-85573-25ul
This item is not returnable.
View return policy
Description
LDB1 Polyclonal specifically detects LDB1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| LDB1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| carboxy terminal LIM domain protein 2, Carboxyl-terminal LIM domain-binding protein 2, CLIM-2, CLIM2hLdb1, LDB-1, LIM domain binding 1, LIM domain-binding factor-1, LIM domain-binding protein 1, NLILIM domain-binding factor CLIM2, Nuclear LIM interactor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8861 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LDB1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW | |
| 25 μL | |
| Primary | |
| Specificity of human LDB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction