missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500001

LASP1 Antibody [DyLight 594], Novus Biologicals Biologicals™

Product Code. 30500001 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500001 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500001 Supplier Novus Biologicals Supplier No. NBP338061DL594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

LASP1 Polyclonal antibody specifically detects LASP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen LASP1
Applications ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 594
Formulation 50mM Sodium Borate
Gene Alias LASP-1, LIM and SH3 domain protein 1, LIM and SH3 protein 1, Metastatic lymph node gene 50 protein, MLN 50, MLN50Lasp-1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1).,, Sequence:, RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3927
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.