missing translation for 'onlineSavingsMsg'
Learn More

LASP1 Antibody [Alexa Fluor« 532], Novus Biologicals Biologicals™

Product Code. 30498667 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498667 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498667 Supplier Novus Biologicals Supplier No. NBP338061AF532

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

LASP1 Polyclonal antibody specifically detects LASP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen LASP1
Applications ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 532
Formulation 50mM Sodium Borate
Gene Alias LASP-1, LIM and SH3 domain protein 1, LIM and SH3 protein 1, Metastatic lymph node gene 50 protein, MLN 50, MLN50Lasp-1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1).,, Sequence:, RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3927
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.