missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500718

katanin-p80 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Product Code. 30500718 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500718 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500718 Supplier Novus Biologicals Supplier No. NBP337906JF525

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

katanin-p80 Polyclonal antibody specifically detects katanin-p80 in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen katanin-p80
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Janelia Fluor 525
Formulation 50mM Sodium Borate
Gene Alias KAT, katanin (80 kDa), katanin p80 (WD repeat containing) subunit B 1, katanin p80 (WD40-containing) subunit B 1, Katanin p80 subunit B1, katanin p80 WD40-containing subunit B1, p80 katanin
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human katanin-p80 (NP_005877.2).,, Sequence:, SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10300
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.