missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500432

ILF1 Antibody [DyLight 488], Novus Biologicals Biologicals™

Product Code. 30500432 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500432 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500432 Supplier Novus Biologicals Supplier No. NBP335424G

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ILF1 Polyclonal antibody specifically detects ILF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen ILF1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 488
Formulation 50mM Sodium Borate
Gene Alias Cellular transcription factor ILF-1, forkhead box K2, forkhead box protein K2, FOXK1, ILF-1, ILF1ILF, interleukin enhancer binding factor 1, Interleukin enhancer-binding factor 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human ILF1 (NP_004505.2).,, Sequence:, TPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 3607
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.