missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ILF1 Polyclonal antibody specifically detects ILF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | ILF1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Cellular transcription factor ILF-1, forkhead box K2, forkhead box protein K2, FOXK1, ILF-1, ILF1ILF, interleukin enhancer binding factor 1, Interleukin enhancer-binding factor 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human ILF1 (NP_004505.2).,, Sequence:, TPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?