missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209890

Invitrogen™ Human ZRANB1 (aa 572-665) Control Fragment Recombinant Protein

Product Code. 30209890
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209890 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209890 Supplier Invitrogen™ Supplier No. RP95813

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56090 (PA5-56090. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZRANB1 is a positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains. It acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription and may also modulate TNF-alpha signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UGI0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54764
Name Human ZRANB1 (aa 572-665) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9330160G10Rik; D7Wsu87e; DKFZp762P2216; Gm1956; hTrabid; Trabid; TRAF-binding domain-containing protein; TRAF-binding protein; TRAF-binding protein domain; ubiquitin thioesterase ZRANB1; Zinc finger Ran-binding domain-containing protein 1; zinc finger RANBP2-type containing 1; zinc finger, RAN-binding domain containing 1; ZRANB1
Common Name ZRANB1
Gene Symbol ZRANB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CWKSPIALGYTRGHFSALVAMENDGYGNRGAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREWLDCCVTEGGVLVAMQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.