missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF79 Partial ORF (NP_009066.1, 52 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007633-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137785

  • 335.00 € / 10µg
Estimated Shipment: 28-05-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF
Specifications

Specifications

NP_009066.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF
RUO
ZNF79
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
7633
ZNF79 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
pT7
ZNF79
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions