missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF239 Partial ORF (NP_005665.1, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_005665.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 8187
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16138285
View Documents Promotion Details
Abnova™
H00008187-Q01.10UG
10 ug
335.00 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16148285
View Documents Promotion Details
Abnova™
H00008187-Q01.25UG
25 ug
508.00 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM]

Sequence: MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE
Specifications

Specifications

NP_005665.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOK-2/MOK2
ZNF239
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
8187
ZNF239 (Human) Recombinant Protein (Q01)
MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE
RUO
ZNF239
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications