missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human WSB2 Partial ORF (AAH15887, 1 a.a. - 105 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
344.00 € - 521.00 €
Specifications
| Accession Number | AAH15887 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 55884 |
| Molecular Weight (g/mol) | 37.29kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16148486
|
Abnova™
H00055884-Q01.25ug |
25 μg |
521.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16138486
|
Abnova™
H00055884-Q01.10ug |
10 μg |
344.00 €
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. [provided by RefSeq]
Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPSpecifications
| AAH15887 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.29kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC10210/SBA2 | |
| WSB2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 55884 | |
| WSB2 (Human) Recombinant Protein (Q01) | |
| MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSP | |
| RUO | |
| WSB2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title