missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human WSB2 Partial ORF (AAH15887, 1 a.a. - 105 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Specifications
Accession Number | AAH15887 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 55884 |
Molecular Weight (g/mol) | 37.29kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16148486
|
Abnova™
H00055884-Q01.25UG |
25 ug |
508.00 €
25µg |
Estimated Shipment: 04-09-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16138486
|
Abnova™
H00055884-Q01.10UG |
10 ug |
335.00 €
10µg |
Estimated Shipment: 04-09-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. [provided by RefSeq]
Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPSpecifications
AAH15887 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.29kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC10210/SBA2 | |
WSB2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
55884 | |
WSB2 (Human) Recombinant Protein (Q01) | |
MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSP | |
RUO | |
WSB2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |