missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WAC (aa 539-622) Control Fragment Recombinant Protein

Product Code. 30209279
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209279

Brand: Invitrogen™ RP106031

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65336 (PA5-65336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The WW domain containing adaptor with coiled-coil protein (WAC) contains a WW domain that mediates protein-protein interactions and colocalizes with RNA splicing factor SC35. Further studies have indicated that WAC is a functional partner of the RNF20/40 complex that ubiquitinates Histone H2B, and that WAC regulates H2B ubiquitination. WAC targets RNF20/40 to associate with RNA polymerase II complex for H2B ubiquitination at active transcription sites. WAC-dependent transcription is also important for cell-cycle checkpoint activation in response to genotoxic stress.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BTA9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51322
Name Human WAC (aa 539-622) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110067P07Rik; A230035H12Rik; AI256735; AI256776; BM-016; DESSH; Kiaa1844; PRO1741; RGD1562407; Wac; WW domain containing adaptor with coiled-coil; WW domain-containing adapter protein with coiled-coil; WW domain-containing adaptor with coiled-coil; WW domain-containing protein 4; Wwp4
Common Name WAC
Gene Symbol Wac
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NATVVPQNSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.