missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human VIPR1 Partial ORF (NP_004615, 393 a.a. - 457 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007433-Q01.10ug
This item is not returnable.
View return policy
Description
This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq]
Sequence: GEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLVSpecifications
| NP_004615 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.89kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV | |
| RUO | |
| VIPR1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 7433 | |
| VIPR1 (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ41949/HVR1/II/PACAP-R-2/RDC1/VAPC1/VIPR/VIRG/VPAC1/VPCAP1R | |
| VIPR1 | |
| Recombinant | |
| wheat germ expression system |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction