missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human VCP Partial ORF (AAH07562.2, 221 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007415-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16084935

  • 341.70 € / 10µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. [provided by RefSeq]

Sequence: IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
Specifications

Specifications

AAH07562.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
RUO
VCP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7415
VCP (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IBMPFD/MGC131997/MGC148092/MGC8560/TERA/p97
VCP
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions