missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VAM1 (aa 61-158) Control Fragment Recombinant Protein

Product Code. 30205147
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205147

Brand: Invitrogen™ RP92644

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82663 (PA5-82663. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1), ZO1-like (see TJP1), p55-like (see MPP1), and LIN2-like (see CASK), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZW5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51678
Name Human VAM1 (aa 61-158) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CH474011:EDL88200; Dlgh4; Dlgh4 protein; Fibroblast growth factor-inducible protein 15; MAGUK p55 subfamily member 6; MAGUK protein p55T; membrane palmitoylated protein 6; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 6); membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); Mpp6; P55t; P55T protein; Pals2; protein associated with Lin7 2; protein associated with Lin-7 2; VAM1; VAM-1; VELI-associated MAGUK 1
Common Name VAM1
Gene Symbol MPP6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.