missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UBE2C Partial ORF (AAH16292.1, 25 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011065-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055295

  • 545.00 € / 25µg

Estimated Shipment: 23-11-2022
to see stock.
Add to basket

Description

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Specifications

Specifications

AAH16292.1
Liquid
11065
UBE2C (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
UBCH10/dJ447F3.2
UBE2C
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
RUO
UBE2C
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions