missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208086

Invitrogen™ Human Tug (aa 186-266) Control Fragment Recombinant Protein

Product Code. 30208086
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208086 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208086 Supplier Invitrogen™ Supplier No. RP92574

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55404 (PA5-55404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a candidate gene for alveolar soft part sarcoma (ASPS). It has been found that this gene is fused with transcription factor TFE3 gene in ASPS and also in renal cell carcinomas. Several alternatively spliced transcript variants of this gene have been described, but their full length nature has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BZE9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79058
Name Human Tug (aa 186-266) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190006K01Rik; alveolar soft part sarcoma chromosomal region candidate gene 1 protein; Alveolar soft part sarcoma chromosomal region candidate gene 1 protein homolog; alveolar soft part sarcoma chromosome region, candidate 1; alveolar soft part sarcoma chromosome region, candidate 1 (human); alveolar soft part sarcoma locus; ASPC; ASPCR1; ASPL; ASPS; Aspscr1; ASPSCR1, UBX domain containing tether for SLC2A4; RCC17; renal cell carcinoma gene on chromosome 17; renal cell carcinoma, papillary, 17; renal papillary cell carcinoma protein 17; Tether containing UBX domain for GLUT4; tether, containing a UBX domain, for GLUT4; TUG; UBX domain protein 9; UBX domain-containing protein 9; UBXD9; UBXN9
Common Name Tug
Gene Symbol ASPSCR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.