missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TSC2 (aa 1723-1807) Control Fragment Recombinant Protein

Product Code. 30206965
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206965

Brand: Invitrogen™ RP106241

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSC2 (Tuberin, Tuberous sclerosis complex, TSC Complex Subunit 2), is implicated as a tumor suppressor and may function in vesicular transport, play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. TSC2 associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Phosphorylation of tuberin on Ser 939 and Thr 1462 regulates its interaction with hamartin, and is stimulated by various growth factors through the phosphoinositide 3-kinase/Akt pathway. TSC2 may have a function in vesicular transport, but may also play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. Interaction between TSC1 and TSC2 may facilitate vesicular docking. TSC2 specifically stimulates the intrinsic GTPase activity of the Ras related protein RAP1A and RAB5, suggesting a possible mechanism for its role in regulating cellular growth. Mutations in TSC2 lead to constitutive activation of RAP1A in tumors and are involved in diseases such as lymphangioleiomyomatosis and TSC2 angiomyolipoma. Alternative splicing results in transcript variants of three different isoforms of TSC2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49815
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7249
Name Human TSC2 (aa 1723-1807) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LAM; Nafld; OTTHUMP00000198394; PPP1R160; protein phosphatase 1, regulatory subunit 160; Rc; renal carcinoma; Tcs2; Tsc2; TSC4; Tuberin; tuberous sclerosis 2; tuberous sclerosis 2 homolog protein; tuberous sclerosis 2 protein; Tuberous sclerosis 2 protein homolog
Common Name TSC2
Gene Symbol TSC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.