missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204396

Invitrogen™ Human TRIP230 (aa 14-148) Control Fragment Recombinant Protein

Product Code. 30204396
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204396

Brand: Invitrogen™ RP89037

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51726 (PA5-51726. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Trip230 gene encodes a protein of 1,978 amino acids with an estimated molecular mass of 230 kDa. The gene is located on chromosome 14q31, which is in a region associated with genetic alterations and thyroid hormone response abnormalities. The Trip230 protein interacts with Rb and thyroid hormone receptor (TR) using two distinct domains. Complex formation with Rb is in a hormone independent manner, but when Trip230 forms a complex with TR, it is in a thyroid hormone-dependent manner. After T3 treatment, Trip230 is phosphorylated and transported to the nucleus, suggesting that phosphorylation may be important for its nuclear translocation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15643
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9321
Name Human TRIP230 (aa 14-148) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACG1A; CEV14; clonal evolution-related gene on chromosome 14 protein; GMAP210; GMAP-210; golgi-associated microtubule-binding protein 210; Golgi-microtubule-associated protein of 210 kDa; thyroid hormone receptor interactor 11; thyroid receptor-interacting protein 11; TR-interacting protein 11; TRIP11; TRIP-11; Trip230
Common Name TRIP230
Gene Symbol TRIP11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSENERLKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQLLKLQSAAQSVPSGAGVPATTASSSFAY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.