missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TR2 (aa 289-372) Control Fragment Recombinant Protein

Product Code. 30208380
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208380 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208380 Supplier Invitrogen™ Supplier No. RP104652

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P13056
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7181
Name Human TR2 (aa 289-372) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4831444H07Rik; 80.3; 80-3 cNDA; ATAR; CD270; CD40-like protein; early embryonic nuclear receptor; Eenr; herpes virus entry mediator A; Herpesvirus entry mediator A; HVEA; HVEM; LIGHTR; mTR2; nr2c1; Nuclear receptor subfamily 2 group C member 1; nuclear receptor subfamily 2, group C isoform; nuclear receptor subfamily 2, group C, member 1; nuclear receptor subfamily 2, group H, member 1; orphan nuclear receptor TR2; orphan receptor, TR2-11; pregnancy specific beta-1-glycoprotein 4; Psg4; testicular receptor 2; TNF receptor superfamily member 14; TNFRSF14; Tr2; TR2 nuclear hormone receptor; Tr2-11; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
Common Name TR2
Gene Symbol Nr2c1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSINYTEKEGPLLSDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.