missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNFRSF1A Partial ORF (NP_001056, 40 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007132-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16034915

  • 359.00 € / 10µg

Estimated Shipment: 23-11-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq]

Sequence: RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
Specifications

Specifications

NP_001056
Liquid
7132
TNFRSF1A (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD120a/FPF/MGC19588/TBP1/TNF-R/TNF-R-I/TNF-R55/TNFAR/TNFR1/TNFR55/TNFR60/p55/p55-R/p60
TNFRSF1A
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC
RUO
TNFRSF1A
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions