missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMEM66 (aa 199-251) Control Fragment Recombinant Protein

Product Code. 30196767
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196767 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196767 Supplier Invitrogen™ Supplier No. RP105987

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65267 (PA5-65267. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Saraf encodes a protein that is a negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the de-oligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96BY9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51669
Name Human TMEM66 (aa 199-251) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810045K07Rik; arrestin-E; FOAP-7; HBV XAg-transactivated protein 3; HBV X-transactivated gene 3 protein; HSPC035; NPD003; Protein FOAP-7; PSEC0019; Saraf; SARAF long isoform; SARAF short isoform; SOCE-associated regulatory factor; store-operated calcium entry associated regulatory factor; store-operated calcium entry-associated regulatory factor; testicular secretory protein Li 59; TMEM66; Transmembrane protein 66; UNQ1967/PRO4499; XTP3
Common Name TMEM66
Gene Symbol SARAF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.