missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TCP-1 theta (aa 400-544) Control Fragment Recombinant Protein

Product Code. 30206525
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206525 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206525 Supplier Invitrogen™ Supplier No. RP91816

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54318 (PA5-54318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCP-1 theta is theta subunit of the CCT (chaperonin containing TCP1 complex) chaperonin molecule which is abundant in the eukaryotic cytosol and may be involved in the transport and assembly of the newly synthesized proteins. Molecular chaperones assist in the protein folding upon ATP hydrolysis and TCP-1 theta may play a role in the assembly of the BBsome, a complex that is involved in ciliogenesis regulating transport vesicles to the cilia. Further, TCP-1 theta is also involved in the folding of actin and tubulin. The intact CCT complex is composed of eight polypeptides in a double ring structure. CCT is important within cells in the folding of the VHL tumor suppressor protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P50990
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10694
Name Human TCP-1 theta (aa 400-544) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI132397; bdav; bette davis; C21orf112; Cct8; Cctq; CCT-theta; Chaperonin containing T-complex polypeptide 1 subunit 8; chaperonin containing TCP1 subunit 8; chaperonin containing TCP1, subunit 8 (theta); chaperonin subunit 8 (theta); D21S246; fa22h09; KIAA0002; PRED71; renal carcinoma antigen NY-REN-15; T-complex protein 1 subunit theta; TCP-1-theta; Tcpq; wu:fa22h09; zgc:56059
Common Name TCP-1 theta
Gene Symbol CCT8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.