missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TAPBPL Partial ORF (NP_060479, 23 a.a. - 121 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_060479
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 55080
Molecular Weight (g/mol) 36.63kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16147876
View Documents Promotion Details
Abnova™
H00055080-Q01.25UG
25 ug
508.00 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16137876
View Documents Promotion Details
Abnova™
H00055080-Q01.10UG
10 ug
335.00 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Tapasin, or TAPBP (MIM 601962), is a member of the variable-constant Ig superfamily that links major histocompatibility complex (MHC) class I molecules to the transporter associated with antigen processing (TAP; see MIM 170260) in the endoplasmic reticulum (ER). The TAPBP gene is located near the MHC complex on chromosome 6p21.3. TAPBPL is a member of the Ig superfamily that is localized on chromosome 12p13.3, a region somewhat paralogous to the MHC.[supplied by OMIM]

Sequence: PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
Specifications

Specifications

NP_060479
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ10143/TAPBP-R/TAPBPR
TAPBPL
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
55080
TAPBPL (Human) Recombinant Protein (Q01)
PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
RUO
TAPBPL
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications