missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203815

Invitrogen™ Human TAP (aa 47-120) Control Fragment Recombinant Protein

Product Code. 30203815
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203815

Brand: Invitrogen™ RP103690

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84506 (PA5-84506. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The constitutive transport element (CTE) of type D retroviruses serves as a signal of nuclear export for unspliced viral RNAs. TAP (also known as NXF1) mediates the export of CTE-containing simian type D retroviral RNAs through binding directly to the CTE. TAP is associated with a recognized mRNA export pathway and is a member of the multigene family of NXF proteins. NXF proteins belong to an evolutionarily conserved family of proteins, which are characterized by a leucine-rich-repeat domain (LRR) followed by a region known as the Nuclear Transport Factor 2 (NTF2)-like domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UBU9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10482
Name Human TAP (aa 47-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Mex 67 homolog; ME x 67; Me x 67 h; modifier of vibrator 1; mRNA export factor TAP; Mvb1; Nuclear RNA export factor 1; nuclear RNA export factor 1 homolog; Nxf1; TAP; tip associated protein; tip associating protein; tip-associated protein; Tip-associating protein; Vdp
Common Name TAP
Gene Symbol NXF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.