missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TAF7L Partial ORF (NP_079161.2, 231 a.a. - 332 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00054457-Q01.10ug
This item is not returnable.
View return policy
Description
This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeq]
Sequence: KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNNSpecifications
| NP_079161.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.96kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN | |
| RUO | |
| TAF7L | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 54457 | |
| TAF7L (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ23157/TAF2Q/dJ738A13.1 | |
| TAF7L | |
| Recombinant | |
| wheat germ expression system |