missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TAF7L Partial ORF (NP_079161.2, 231 a.a. - 332 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054457-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137566

  • 335.00 € / 10µg
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeq]

Sequence: KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN
Specifications

Specifications

NP_079161.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.96kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN
RUO
TAF7L
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
54457
TAF7L (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23157/TAF2Q/dJ738A13.1
TAF7L
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions