missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193837

Invitrogen™ Human STK39 (aa 396-427) Control Fragment Recombinant Protein

Product Code. 30193837
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193837

Brand: Invitrogen™ RP103936

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111553 (PA5-111553. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK39 (STLK3) is involved in the cellular stress response pathway. STK39 is activated in response to hypotonic stress leading to phosphorylation of several cation-chloride-coupled co-transporters. STK39 activates the p38 MAP kinase pathway and its interaction with p38 decreases during cellular stress. STK39 acts as an intermediate in the response to cellular stress. STK39 is also an independent risk factor for hypertension in men and its intragenic SNPs can interact and function in the control of blood pressure.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UEW8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27347
Name Human STK39 (aa 396-427) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW227544; AW556857; DCHT; DKFZp686K05124; kidney-specific SPAK; pancreatic serine/threonine-protein kinase; Pask; proline-alanine-rich STE20-related kinase; PS/TK; PSTK1; RF005; Rnl5; serine threonine kinase 39; serine threonine kinase 39 (STE20/SPS1 homolog, yeast); serine/threonine kinase 39; serine/threonine kinase 39, STE20/SPS1 homolog; serine/threonine-protein kinase 39; small intestine SPAK-like kinase; Spak; Ste-20 related kinase; STE20/SPS1 homolog; STE20/SPS1-related proline-alanine-rich protein kinase; Ste20-like protein kinase; ste-20-related kinase; Stk39
Common Name STK39
Gene Symbol STK39
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.