missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ST8SIA2 Partial ORF (NP_006002, 40 a.a. - 146 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008128-Q01.10ug
Additional Details : Weight : 0.00010kg
Beschreibung
The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29. [provided by RefSeq]
Sequence: TIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSpezifikation
| NP_006002 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.51kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRT | |
| RUO | |
| ST8SIA2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8128 | |
| ST8SIA2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HsT19690/MGC116854/MGC116857/SIAT8B/ST8SIA-II/STX | |
| ST8SIA2 | |
| Recombinant | |
| wheat germ expression system |