missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204636

Invitrogen™ Human SPG21 (aa 234-308) Control Fragment Recombinant Protein

Product Code. 30204636
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204636 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204636 Supplier Invitrogen™ Supplier No. RP104718

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65268 (PA5-65268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NZD8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51324
Name Human SPG21 (aa 234-308) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acid cluster protein 33; ACP33; BM-019; C78576; D9Wsu18e; GL010; Maspardin; MAST; spastic paraplegia 21 (autosomal recessive, Mast syndrome); Spastic paraplegia 21 autosomal recessive Mast syndrome protein; Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog; spastic paraplegia 21 homolog (human); Spastic paraplegia 21 protein; SPG21
Common Name SPG21
Gene Symbol SPG21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.