missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201637

Invitrogen™ Human SPDYA (aa 181-247) Control Fragment Recombinant Protein

Product Code. 30201637
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201637

Brand: Invitrogen™ RP104246

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111053 (PA5-111053, PA5-64267 (PA5-64267. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Speedy A, also known as SPDYA, SPDY1, Ringo3 or SPY1, is a 313 amino acid protein that localizes to the nucleus and belongs to the speedy/ringo family. Expressed at high levels in testis and at lower levels in brain, kidney, heart, bone marrow, colon, lung, liver spleen and placenta, Speedy A functions to regulate the G1/S phase transition of the cell cycle, specifically by binding to and activating Cdc2 p34, Cdk2 and p27. Additionally, Speedy A mediates cell survival during DNA damage, suggesting that Speedy A plays a role in proper cell cycle progression throughout the life of the cell. Multiple isoforms of Speedy A exist due to alternative splicing events. The gene encoding Speedy A maps to human chromosome 2, which encodes over 1,400 genes and comprises nearly 8% of the human genome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5MJ70
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 245711
Name Human SPDYA (aa 181-247) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921517J08Rik; 4930548B21Rik; Gs4; hSpy/Ringo A; Lm23; MLZ-465; mSpy/Ringo A; protein expressed in male leptotene and zygotene spermatocytes 465; Rapid inducer of G2/M progression in oocytes A; RINGO A; RINGO3; RINGOA; SPDY1; SPDYA; spdya {ECO:0000250; speedy A; speedy A1; speedy A2; speedy homolog 1; speedy homolog A; speedy homolog A (Xenopus laevis); speedy protein A; speedy/ringo; speedy/RINGO cell cycle regulator family member A; Speedy-1; spermatogenesis related protein Gs4; spy1; UniProtKB:Q5MJ70}
Common Name SPDYA
Gene Symbol SPDYA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.