missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207578

Invitrogen™ Human SLC7A8 (aa 469-510) Control Fragment Recombinant Protein

Product Code. 30207578
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207578

Brand: Invitrogen™ RP104269

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63887 (PA5-63887. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UHI5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23428
Name Human SLC7A8 (aa 469-510) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4F2-LC5; 4F2LC-5; AA408822; cationic amino acid transporter y+ system; glycoprotein-associated amino acid transporter LAT2; hLAT2; integral membrane protein E16H; Large neutral amino acids transporter small subunit 2; LAT2; Lat4; LPI-PC1; L-type amino acid transporter 2; mLAT2; Slc7a8; solute carrier family 7 (amino acid transporter light chain, L system), member 8; solute carrier family 7 (amino acid transporter, L-type), member 8; solute carrier family 7 (cationic amino acid transporter, y+ system), member 8; solute carrier family 7 member 8; solute carrier family 8 (cationic amino acid transporter, y+ system), member 7
Common Name SLC7A8
Gene Symbol SLC7A8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.