missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC6A19 Partial ORF (NP_001003841, 326 a.a. - 414 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00340024-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16045825

  • 359.00 € / 10µg

Estimated Shipment: 16-11-2022
to see stock.
Add to basket

Description

Description

This gene encodes a system B(0) transmembrane protein that actively transports most neutral amino acids across the apical membrane of epithelial cells. Mutations in this gene result in Hartnup disorder. [provided by RefSeq]

Sequence: GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSP
Specifications

Specifications

NP_001003841
Liquid
340024
SLC6A19 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B0AT1/FLJ20680/FLJ34635/HND
SLC6A19
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSP
RUO
SLC6A19
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions