missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198206

Invitrogen™ Human SLC37A2 (aa 40-85) Control Fragment Recombinant Protein

Product Code. 30198206
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198206 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198206 Supplier Invitrogen™ Supplier No. RP91270

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53260 (PA5-53260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Slc37 gene family consists of four members which have 10-12 predicted transmembrane domains and belong to the sugar-phosphate transporter superfamily. Recent experiments have demonstrated that Slc37A2 is a macrophage-specific gene selectively expressed in obese white adipose tissue. Its transcript is also expressed in spleen and thymus and the cell lines RAW264.7 and THP-1. Compared to wild-type mice, Slc37A2 mRNA is expressed at nine-fold higher levels in abdominal epididymal fat deposits of ob/ob mice, suggesting that it may be required to limit the contribution of macrophages to the inflammatory state present in obesity. Slc37A2 protein is post-translationally modified with the addition of N-linked glycans and migrates as a heterogeneous species of 50-75 kDa.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TED4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 219855
Name Human SLC37A2 (aa 40-85) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cAMP inducible 2 protein; cAMP inducible gene 2; cAMP-inducible protein 2; ci2; cI-2; G3PP; glucose-6-phosphate exchanger SLC37A2; pp11662; RGD1564160; Slc37a1; SLC37A2; solute carrier family 37 (glucose-6-phosphate transporter), member 2; solute carrier family 37 (glycerol-3-phosphate transporter), member 1; solute carrier family 37 (glycerol-3-phosphate transporter), member 2; solute carrier family 37 member 2; sugar phosphate exchanger 2
Common Name SLC37A2
Gene Symbol SLC37A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.