missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208399

Invitrogen™ Human SLC2A13 (aa 260-320) Control Fragment Recombinant Protein

Product Code. 30208399
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208399

Brand: Invitrogen™ RP109004

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140232 (PA5-140232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC2A13 (solute carrier family 2 (facilitated glucose transporter), member 13) is a 648 multi-pass membrane protein that belongs to the major facilitator superfamily and the sugar transporter family. SLC2A13 is a H+-myo-inositol cotransporter that can also transport related stereoisomers. Human SLC2A13 shares 90% identity with its rat homolog. The rat sequence has 12 transmembrane domains, 3 N-glycosylation sites, several motifs important for glucose transport activity, and an endoplasmic reticulum retention signal and dileucine internalization signal in the N-terminal region. SLC2A13 has been shown to specifically transport myoinositol but not hexoses, and decreasing the pH of the extracellular medium from 7.0 to 5.0 markedly increased transport activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96QE2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114134
Name Human SLC2A13 (aa 260-320) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6530403A04; A630029G22Rik; AI505012; Gm308; h(+)-myo-inositol cotransporter; H(+)-myo-inositol symporter; Hmit; proton (H+) myo-inositol symporter; proton myo-inositol cotransporter; proton myo-inositol symporter; SLC2A13; solute carrier family 2 (facilitated glucose transporter), member 13; solute carrier family 2 member 13
Common Name SLC2A13
Gene Symbol SLC2A13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.