missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SDC4 Partial ORF (NP_002990.2, 31 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spécification
Accession Number | NP_002990.2 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 6385 |
Molecular Weight (g/mol) | 36.74kDa |
Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
16195085
|
Abnova™
H00006385-Q01.25UG |
25 ug |
508.00 €
25µg |
Estimated Shipment: 11-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16185085
|
Abnova™
H00006385-Q01.10UG |
10 ug |
335.00 €
10µg |
Estimated Shipment: 11-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22. [provided by RefSeq]
Sequence: DLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSSpécification
NP_002990.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC22217/SYND4 | |
SDC4 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
6385 | |
SDC4 (Human) Recombinant Protein (Q01) | |
DLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVS | |
RUO | |
SDC4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |