missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RUNX2 Partial ORF (NP_004339, 251 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000860-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16033735

  • 545.00 € / 25µg

Estimated Shipment: 18-11-2022
to see stock.
Add to basket

Description

Description

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq]

Sequence: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Specifications

Specifications

NP_004339
Liquid
860
RUNX2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AML3/CBFA1/CCD/CCD1/MGC120022/MGC120023/OSF2/PEA2aA/PEBP2A1/PEBP2A2/PEBP2aA/PEBP2aA1
RUNX2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
RUO
RUNX2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions