missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201784

Invitrogen™ Human RUNX2 (aa 270-374) Control Fragment Recombinant Protein

Product Code. 30201784
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30201784 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30201784 Supplier Invitrogen™ Supplier No. RP102296

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82787 (PA5-82787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RUNX2, a nuclear protein, is a member of the RUNX family of transcription factors and has an Runt DNA-binding domain. It is essential for membranous and endochondral bone formation. It not only regulates osteoblastic differentiation and skeletal morphogenesis but also acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer and with more affinity, as a subunit of a heterodimeric complex. It plays a critical role in increasing TGFBR1 expression by osteoblasts and functions in cooperation with DLX5 or a related factor to activate osteoblast-specific gene expression. Mutations lead to disorders in bone development like cleidocranial dysplasia (CCD).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13950
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 860
Name Human RUNX2 (aa 270-374) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Acute myeloid leukemia 3 protein; AKV core binding factor; Aml3; AML-3; Cbf; Cbfa1; Cbfa-1; CBF-alpha-1; CCD; CCD1; CLCD; core binding factor alpha 1; core binding factor alpha 1 subunit; core-binding factor subunit alpha-1; core-binding factor, runt domain, alpha subunit 1; LOW QUALITY PROTEIN: runt-related transcription factor 2; LS3; Oncogene AML-3; Osf2; OSF-2; osteoblast-specific transcription factor 2; PEA2aA; PEA2-alpha A; PEBP2 alpha A; PEBP2A; Pebp2a1; PEBP2aA; PEBP2-alpha A; Pebpa2a; Polyomavirus enhancer-binding protein 2 alpha A subunit; runt domain, alpha subunit 1; runt related transcription factor 2; runt-related transcription factor 2; RUNX 2; RUNX family transcription factor 2; Run x 2; RUNX-2; SL3/AKV core-binding factor alpha A subunit; SL3-3 enhancer factor 1 alpha A subunit; transcription factor RUN x 2; transcription factor RUN x 2/CBFA1
Common Name RUNX2
Gene Symbol RUNX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.