missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RRAS (aa 146-175) Control Fragment Recombinant Protein

Product Code. 30211739
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211739

Brand: Invitrogen™ RP107002

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66321 (PA5-66321. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras superfamily of small GTPases includes the Ras, Rho, Arf, Rab, and Ran families. Ras-regulated signal pathways control such as actin cytoskeletal integrity, proliferation, differentiation, cell adhesion, apoptosis, and cell migration. These GTPases function as molecular switches that control eukaryotic cell function by cycling between two interconvertible forms, a GDP-bound inactive form and a GTP-bound active form. The binding of GTP leads to a conformational change in the downstream effector-binding domain of the G-protein. The small GTPases are monomeric G-proteins with molecular masses over the range 20-30 kDa. Ras is attached to the cell membrane by prenylation. Mutations in the Ras family of proto-oncogenes (comprising H-Ras, N-Ras and K-Ras) are very common, being found in 20% to 30% of all human tumours. The frequency of RAS mutations is among the highest for any gene in human cancer. K-ras mutations occur frequently in non-small-cell lung, colorectal, and pancreatic carcinomas; H-ras mutations are common in bladder, kidney, and thyroid carcinomas; N-ras mutations are found in melanoma, hepatocellular carcinoma, and hematologic malignancies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10301
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6237
Name Human RRAS (aa 146-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI573426; Harvey rat sarcoma oncogene, subgroup R; Harvey rat sarcoma virus oncogene, subgroup R; oncogene RRAS; p23; ras family small GTP binding protein R-Ras; ras-related protein R-Ras; Ras-related protein R-RAS (P23); related RAS viral (r-ras) oncogene homolog; RRAS
Common Name RRAS
Gene Symbol RRAS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LESQRQVPRSEASAFGASHHVAYFEASAKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.